PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000371t1
Common NameTCM_000371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family ZF-HD
Protein Properties Length: 386aa    MW: 43164.6 Da    PI: 9.0846
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000371t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1062.3e-33158212459
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       +rY+eC+kNhAas+G+h++DGCgEfmps geegt++alkCaAC+CHRnFHR+e + 
  Thecc1EG000371t1 158 IRYRECMKNHAASMGSHVMDGCGEFMPS-GEEGTPEALKCAACECHRNFHRKEING 212
                       79*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-21158211IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-30158210IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.6E-30159210IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.54160209IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.4E-30295369IPR009057Homeodomain-like
SuperFamilySSF466891.15E-19297368IPR009057Homeodomain-like
PROSITE profilePS500718.762305369IPR001356Homeobox domain
TIGRFAMsTIGR015652.7E-28307364IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MLKQSCLCLL GLNLMELLTV REFLHQKLMS DQFNSSRDSS SKVSSSAPIN SGVGERRRDQ  60
TVHGDTTVLN PNPPQTLDLH PLYHPELNPQ HQIHKPRRDP DPDPDPDPVS APTATTSATV  120
TASANRSSLK SPQQQPPTSQ PPPVAAASPT TISSTPLIRY RECMKNHAAS MGSHVMDGCG  180
EFMPSGEEGT PEALKCAACE CHRNFHRKEI NGETQYAPSC YYSYNPNKNN NRRDTTHPPS  240
QLHPQQPIPL HQQRFSLGLS TSPTAMPIAP VMMNFRGGGP AESSSEDLNM FHSNAGGQIS  300
AQPQSSKKRF RTKFSQEQKD KMMEFAEKLG WRIQKQDEQE VQQFCAQVGV KRQVFKVWMH  360
NNKQAMKKKQ IWPHQSYRLK ETYPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-243063651675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1487359e-47EF148735.1 Populus trichocarpa x Populus deltoides clone WS0137_D14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046919.10.0Homeobox protein 24, putative
SwissprotQ9ZPW74e-69ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A061DH370.0A0A061DH37_THECC; Homeobox protein 24, putative
STRINGPOPTR_0005s12420.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-66homeobox protein 24
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]